PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 185898
Common NameSELMODRAFT_161550, SELMODRAFT_185898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family CO-like
Protein Properties Length: 364aa    MW: 38714.2 Da    PI: 6.1424
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
185898genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.11.8e-084690442
  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
               +C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
    185898 46 LVCEVCEHAPAAVTCKADAAALCVTCDSDIHSAnplarrHERVPI 90
              68*****************************66899999*99997 PP

2CCT69.96.5e-24305348144
     CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
             Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ 
  185898 305 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRG 348
             9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.5E-7147IPR000315B-box-type zinc finger
PROSITE profilePS501199.869147IPR000315B-box-type zinc finger
CDDcd000219.37E-6447No hitNo description
PROSITE profilePS5011911.224390IPR000315B-box-type zinc finger
PfamPF006431.6E-64590IPR000315B-box-type zinc finger
CDDcd000211.01E-74790No hitNo description
SMARTSM003365.8E-114890IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787305347IPR010402CCT domain
PfamPF062034.4E-18305347IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MTKPCDACQS GNAVIYCRAD AAFLCCSCDN KVHCANKLAS RHERVLVCEV CEHAPAAVTC  60
KADAAALCVT CDSDIHSANP LARRHERVPI TPFVDSSDGG AAPPPAPPIL HDTGNANHDD  120
EEESSAAEAA SWLLPQPNNL AKSDGEKLGG GVESTDFYST LKPSAPPPLR IEKLLLKSQA  180
AANFDLFSDE DSYLDMDFLG ALHSVTDSLV PIHTTGGALH SSSPVGSNAD SYDLDVHDKS  240
PPHAYCPGLS LSASSIDVGV VPDASLSDIS TPQSRPTSSS VFGSGEAQAA AAPLHHATPL  300
EPIAREARVL RYREKRKNRK FEKTIRYASR KAYAETRPRI KGRFAKRGEM DSYDASFGVV  360
PSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002991192.10.0hypothetical protein SELMODRAFT_185898
RefseqXP_002991255.10.0hypothetical protein SELMODRAFT_161550
SwissprotQ940T91e-85COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLD8T6J40.0D8T6J4_SELML; Putative uncharacterized protein
STRINGEFJ076830.0(Selaginella moellendorffii)
STRINGEFJ077360.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.15e-80CONSTANS-like 4
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]